PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.19G224600.1.p
Common NameGLYMA_19G224600, LOC100788976
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 435aa    MW: 48445.7 Da    PI: 7.4036
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.19G224600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.11.9e-181461148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
  Glyma.19G224600.1.p 14 KGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                         678*******************************************97 PP

2Myb_DNA-binding42.21.9e-1367110146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          rg+++++E+  ++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  Glyma.19G224600.1.p  67 RGAFSQQEENSIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                          89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-27664IPR009057Homeodomain-like
PROSITE profilePS5129425.407965IPR017930Myb domain
SuperFamilySSF466894.49E-2912108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002493.2E-161461IPR001005SANT/Myb domain
CDDcd001674.90E-121761No hitNo description
Gene3DG3DSA:1.10.10.606.8E-2565116IPR009057Homeodomain-like
SMARTSM007172.0E-1166114IPR001005SANT/Myb domain
PROSITE profilePS5129419.25166116IPR017930Myb domain
PfamPF002491.9E-1267111IPR001005SANT/Myb domain
CDDcd001675.21E-869109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQQEENSIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQRG  120
IDPNTHQPLS EVENDKDKPL TADKSNQKAS NEVSLIEPPK PKPISTTSMP MDRYPLEVSS  180
TFKISGGNNN NNNSNSTLDR FDSSITSSDM MGMGYFPFQH LNYGSNMGLT TTPNNTPLCF  240
MPSSTSSQMM SELNSTMLHS MFPTHVKPTV SLHSNNNNNP SSISSDGVQN WETSTFSNNN  300
NASKSNGSSS CSIQLQSGST NFLDHSSTIT WGLQAESATK ADKDAHVVVP LQSSEQEDIK  360
WSEYLNNTPF SLGTMSVQHQ TTNSLYSSDE VKPETTGFIA DESSTSWHHS QHFQPSEIYT  420
KDLQRFSVAF GQTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.351620.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2351800.0AC235180.1 Glycine max strain Williams 82 clone GM_WBb0008A05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003553691.10.0PREDICTED: transcription factor MYB86-like
TrEMBLI1NBM20.0I1NBM2_SOYBN; Uncharacterized protein
STRINGGLYMA19G41250.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-106myb domain protein 61